DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and MEKK3

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_192587.1 Gene:MEKK3 / 826406 AraportID:AT4G08470 Length:560 Species:Arabidopsis thaliana


Alignment Length:286 Identity:103/286 - (36%)
Similarity:147/286 - (51%) Gaps:26/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KKLSEESLLQPPEKVFDIM-----YKLGEGSYGSVYKAVHKESSSIVAIKLVPV-------ESDL 79
            :||....|::...|..||.     ..||.|||.|||:|: .|.....|:|.|.:       :..:
plant   283 RKLMRNKLIENFRKPEDITSWLKGQLLGRGSYASVYEAI-SEDGDFFAVKEVSLLDKGIQAQECI 346

  Fly    80 HEIIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSD 144
            .::..||:::.|.....:|||.|:......|:|.:|....|||..:  ..:..|:...::.....
plant   347 QQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKL--YERYQLSYTVVSLYTRQ 409

  Fly   145 TLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGV--AGQLTDTMAKRNTVIGTPFWMAPEV 207
            .|.||.|||.:..:|||||.||:|::..|..||||||:  |.:..|.|:.:    ||.|||||||
plant   410 ILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCK----GTLFWMAPEV 470

  Fly   208 I---EEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDF 269
            |   :..|....|||||||.|.|||..|:.||.::.|::|.|.|.:...|..  ||..|.:...|
plant   471 INRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDV--PDTLSLDARHF 533

  Fly   270 VSKCLVKEPDDRATATELLEHEFIRN 295
            :..||...|::|.||.|||.|.|:.|
plant   534 ILTCLKVNPEERPTAAELLHHPFVIN 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 98/271 (36%)
S_TKc 42..293 CDD:214567 97/267 (36%)
Mst1_SARAH 608..655 CDD:288481
MEKK3NP_192587.1 PKc_like 302..557 CDD:328722 95/263 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.