DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and MAP4K2

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_024304397.1 Gene:MAP4K2 / 5871 HGNCID:6864 Length:860 Species:Homo sapiens


Alignment Length:436 Identity:148/436 - (33%)
Similarity:228/436 - (52%) Gaps:61/436 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVE--SDLHEIIKEISIMQQCDSPYV 97
            ||.|...|:::.::|.|:||.||||....:|.:.|:|:|.::  .|:..:.:||:|:::|..|.|
Human     9 LQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNV 73

  Fly    98 VRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDI 162
            |.|.|||.:...||||||:||.||:.:|.. ....|.|.:||.:..:.|:||.:||.:.||||||
Human    74 VAYIGSYLRNDRLWICMEFCGGGSLQEIYH-ATGPLEERQIAYVCREALKGLHHLHSQGKIHRDI 137

  Fly   163 KAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI---EEIGYDCVADIWSLGI 224
            |.||:||..:|..|||||||:|:||.::|||.:.||||:||||||.   .:.||:.:.|:|:|||
Human   138 KGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVERKGGYNELCDVWALGI 202

  Fly   225 TALEMAEGKPPYGEIHPMRAIFMIPQK--PPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATEL 287
            ||:|:.|.:||...:|||||:.::.:.  .||..|:..||:..|..|:...|.|.|..|.||.:|
Human   203 TAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEKL 267

  Fly   288 LEHEFIRNAKHRSILKPMLEETCAIREQQRANRSFGGVLAASQAKSLATQENGMQQHITDNAFME 352
            |:|.|......|::|..:|::.                                          .
Human   268 LQHPFTTQQLPRALLTQLLDKA------------------------------------------S 290

  Fly   353 DP--GTLVPEKFGEYQQSSASDATMIAHAEQGVDEGTLGPGGLR-NLSKAAAPAAASSAASPLDM 414
            ||  ||..||.. |.:.......|:.:..:.|..|.|  |..:: :..|..||....:  .||:.
Human   291 DPHLGTPSPEDC-ELETYDMFPDTIHSRGQHGPAERT--PSEIQFHQVKFGAPRRKET--DPLNE 350

  Fly   415 PAVDSGTMV---ELESNLGTMVINSDSDDSTTAKNNDDQKPRNRYR 457
            |..:..|::   ||..:|...|..:..:.|.|.::..:.:..:|.|
Human   351 PWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQVPHRGR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 115/261 (44%)
S_TKc 42..293 CDD:214567 114/257 (44%)
Mst1_SARAH 608..655 CDD:288481
MAP4K2XP_024304397.1 STKc_MAP4K3_like 16..272 CDD:270788 114/256 (45%)
CNH 528..840 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.