DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and PAK6

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001263646.1 Gene:PAK6 / 56924 HGNCID:16061 Length:681 Species:Homo sapiens


Alignment Length:281 Identity:107/281 - (38%)
Similarity:158/281 - (56%) Gaps:10/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHE--IIKEISIMQQCDSPYVVRY 100
            |..:.|...|:||||.|.|..|..|.|...||:|::.:......  :..|:.||:......||..
Human   403 PRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEM 467

  Fly   101 YGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAA 165
            |.||....:||:.||:...|:::||  :.:..|.|::|||:....||.|.|||.:..||||||:.
Human   468 YKSYLVGEELWVLMEFLQGGALTDI--VSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSD 530

  Fly   166 NILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMA 230
            :|||..:|..||:|||...|::..:.||.:::|||:|||||||....|....|||||||..:||.
Human   531 SILLTLDGRVKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMV 595

  Fly   231 EGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRN 295
            :|:|||....|::|:..:...|||..:...:.|....||:.:.||::|.:||||.|||:|.|:..
Human   596 DGEPPYFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ 660

  Fly   296 AKHRSILKPMLE------ETC 310
            ......|.|:::      .||
Human   661 TGLPECLVPLIQLYRKQTSTC 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 102/256 (40%)
S_TKc 42..293 CDD:214567 101/252 (40%)
Mst1_SARAH 608..655 CDD:288481
PAK6NP_001263646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PBD 11..67 CDD:307091
Linker 26..406 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..169
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..256
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..355
STKc_PAK6 385..681 CDD:270821 105/279 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.