DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and Pak

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:323 Identity:120/323 - (37%)
Similarity:190/323 - (58%) Gaps:18/323 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SVVDMKSPNISSSCSFFKLKKLSEESLLQ---------PPEKVFDIMYKLGEGSYGSVYKAVHKE 63
            :|....:||..::.:  |.||:|:|.:|:         .|.:.:..|.|:|:|:.|:||.|:...
  Fly   525 AVAPAATPNTRAANA--KKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESS 587

  Fly    64 SSSIVAIKLVPVESDLHE--IIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIM 126
            :...||||.:.:.....:  ||.||.:|::...|.||.|..||....:||:.|||...||::|: 
  Fly   588 TGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDV- 651

  Fly   127 RLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMA 191
             :.:..:.|.:||.:..:.||.|.:||..:.||||||:.||||..:|..||.|||...|::...:
  Fly   652 -VTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQS 715

  Fly   192 KRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSF 256
            ||.|::|||:||||||:....|....|:|||||.|:||.||:|||...:|::|:::|.....|..
  Fly   716 KRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEI 780

  Fly   257 REPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPMLEETCAIREQQRAN 319
            :|.|:.|:.|.||:.:||..|.|.||:|.:||:|.|::.|:..:.|.|::   .|.:|..:.|
  Fly   781 KEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLI---MAAKEATKGN 840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 104/256 (41%)
S_TKc 42..293 CDD:214567 103/252 (41%)
Mst1_SARAH 608..655 CDD:288481
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 105/261 (40%)
S_TKc 566..817 CDD:214567 103/252 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.