DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and CaMKI

DIOPT Version :10

Sequence 1:NP_611427.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:42 Identity:12/42 - (28%)
Similarity:21/42 - (50%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EIGTGYY--VENDLDSAKEFFKRRIEYVQEQLEKIEMMGIEK 134
            ::.|.|:  ::.|.:..||      .|:.|.|.. |::.|||
  Fly    96 DLRTKYFTMIKTDYEDGKE------AYITETLPG-ELLRIEK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_611427.1 STKc_MST1_2 38..293 CDD:132943 12/42 (29%)
SARAH_Hpo 606..661 CDD:439183
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.