DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and Pak3

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster


Alignment Length:288 Identity:99/288 - (34%)
Similarity:163/288 - (56%) Gaps:14/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVES----DLHEIIKEISIMQQCDSPYVV 98
            |.:.:....::|:|:.|.|:.|...::.|.||:|.:.:::    ||  |:.||.:::..:...:|
  Fly   289 PRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL--ILTEIRVLKDFNHKNLV 351

  Fly    99 RYYGSYFKQYD--LWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRD 161
            .:..:|..:.:  ||:.|||...|.::|:  :.:..:.|.:||.:..:||..:.:||.:..||||
  Fly   352 NFLDAYLLEPEDQLWVVMEYMDGGPLTDV--VTETVMKERQIACVCRETLYAISFLHAKGIIHRD 414

  Fly   162 IKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITA 226
            ||:.|:||..:|..|:.|||....: :...||.|::|||:||||||:....|....||||:||.|
  Fly   415 IKSDNVLLGMDGSVKVTDFGFCANI-EGDEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMA 478

  Fly   227 LEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHE 291
            :||.||:|||....|:||:::|.....|..:..|:.|....||:.:||..|.|.||||.|||.|.
  Fly   479 IEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHP 543

  Fly   292 FIRNAKHRSILKPMLEETCAIREQQRAN 319
            |:.:......|.|.::   |.::..|.|
  Fly   544 FLNDCSEVKALVPNIK---AAKKVLRRN 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 93/260 (36%)
S_TKc 42..293 CDD:214567 92/256 (36%)
Mst1_SARAH 608..655 CDD:288481
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 93/260 (36%)
S_TKc 293..545 CDD:214567 92/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.