DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and stk24b

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005165890.1 Gene:stk24b / 406786 ZFINID:ZDB-GENE-040426-2841 Length:432 Species:Danio rerio


Alignment Length:390 Identity:163/390 - (41%)
Similarity:236/390 - (60%) Gaps:27/390 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPV---ESDLHEIIKEISIMQQCD 93
            ::|...||::|..:.::|:||:|.|:|.:...:..:||||::.:   |.::.:|.:||:::.|||
Zfish    14 QNLKADPEELFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCD 78

  Fly    94 SPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKI 158
            ||:|.:|||||.|...|||.|||.|.||..|:  |...:|.|.:|||||.:.|:||.|||..:||
Zfish    79 SPFVTKYYGSYLKDTKLWIIMEYLGGGSALDL--LEPGSLDETQIATILREILKGLEYLHSEKKI 141

  Fly   159 HRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLG 223
            ||||||||:||:.:|..||||||||||||||..||||.:|||||||||||::..||..|||||||
Zfish   142 HRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLG 206

  Fly   224 ITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELL 288
            |||:|:|:|:||:.::|||:.:|:||:..||:..  ..:.....:||..||.|||..|.||.|||
Zfish   207 ITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLE--GNYCKPLKEFVEACLNKEPSFRPTAKELL 269

  Fly   289 EHEFI-RNAKHRSILKPMLEETCAIR-EQQRANRSFGGVLAASQAKSLATQENGMQQHI-----T 346
            :|:.| |.||..|.|..::::....: ||.||..|.....:....::....:.|....|     .
Zfish   270 KHKLIVRFAKKTSYLTELIDKYKRWKAEQSRAESSSDESDSEPDGQASGGNDFGNDDWIFTIREK 334

  Fly   347 DNAFMEDPGTLVPEKFGEYQQSSASDATMIAHAEQGVDEGTLGPGGLRNLSKAAAPAAASSAASP 411
            |...:::..:||.|:....:..|.|.:|:|...             |..|.:.|..|||::...|
Zfish   335 DPKKLQNGASLVGEEEPNKRPLSQSLSTVITPV-------------LTELKEGAGEAAAATTVKP 386

  Fly   412  411
            Zfish   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 134/257 (52%)
S_TKc 42..293 CDD:214567 132/253 (52%)
Mst1_SARAH 608..655 CDD:288481
stk24bXP_005165890.1 STKc_MST3_like 22..295 CDD:270786 138/276 (50%)
S_TKc 24..274 CDD:214567 132/253 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D967913at2759
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.