DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and Myo3b

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001380706.1 Gene:Myo3b / 366069 RGDID:1560313 Length:1333 Species:Rattus norvegicus


Alignment Length:340 Identity:135/340 - (39%)
Similarity:205/340 - (60%) Gaps:29/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIK-EISIMQQCDS- 94
            |||..|.: .::|...:|:|:||.|||..::...|:.|:|::...:|:.|.:: |.:|:|...| 
  Rat    34 ESLPDPMD-TWEIRETIGKGTYGKVYKVANRRDGSLAAVKILDSVNDVDEEVEAEYNILQFLPSH 97

  Fly    95 PYVVRYYGSYFKQ-----YDLWICMEYCGAGSVSDIMR--LR-KKTLTEDEIATILSDTLQGLVY 151
            |.||::||.::|.     ..||:.:|.|..|||:::::  || .|.|.|..|:.||..:|.||.:
  Rat    98 PNVVKFYGMFYKADRCVGGQLWLVLELCNGGSVTELVKGLLRCGKRLDEALISYILYGSLLGLQH 162

  Fly   152 LHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIE-----EI 211
            ||..|.||||:|..||||.|||..||.||||:.|||.|..:|||.:|||||||||||.     :.
  Rat   163 LHHHRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQYDS 227

  Fly   212 GYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVK 276
            .||...|:|||||||:|:.:|.||..|:||::.:|.||:.|||:...||.|..||..|:|:||:|
  Rat   228 SYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPRNPPPTLLHPDNWCEEFNHFISQCLIK 292

  Fly   277 EPDDRATATELLEHEFIRNAKHRSI-LKPMLEETCAIREQQRANRSFGGVLAASQAKSLATQENG 340
            :.:.|.:.|.||:|.||:..:.:.: |:..|.:  .:.:|:..|     .:|.::.:.:.|   |
  Rat   293 DFEKRPSVTHLLDHPFIKGTQGKVLFLQKQLAK--VLWDQKHQN-----PVAKTRHERMHT---G 347

  Fly   341 MQQHITD--NAFMED 353
            ...|:.|  ...:||
  Rat   348 RPHHVEDAGKCCLED 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 118/269 (44%)
S_TKc 42..293 CDD:214567 118/265 (45%)
Mst1_SARAH 608..655 CDD:288481
Myo3bNP_001380706.1 MYSc_Myo3 373..1062 CDD:276830
IQ 1102..1124 CDD:197470
PKc_like 20..310 CDD:419665 123/276 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.