DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and max-2

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001300485.1 Gene:max-2 / 3565400 WormBaseID:WBGene00003144 Length:649 Species:Caenorhabditis elegans


Alignment Length:301 Identity:114/301 - (37%)
Similarity:181/301 - (60%) Gaps:18/301 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KKLSEESLLQPPEKV---------FDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHE- 81
            :|||:..:|....::         :::..::|.|:.|:|:.|....|:.:||:|.:..::...: 
 Worm   355 EKLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKE 419

  Fly    82 -IIKEISIMQQCDSPYVVRYYGSYFKQY-DLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSD 144
             ::.||.:|:|...|.:|.|..||.... |||:.|:|...|:::|:  :.|..|.|.:||.:|.:
 Worm   420 MLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDV--VVKTELDEGQIAAVLQE 482

  Fly   145 TLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIE 209
            .|:.|.:||....:|||||:.|:||...|..||.|.|...|: ...:||:||:|||:||:||::.
 Worm   483 CLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-QPGSKRDTVVGTPYWMSPEILN 546

  Fly   210 EIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCL 274
            :..|:...|||||||.||||.:|:|||....|::||::|.|...|..::.||.|:||.:|:.|||
 Worm   547 KKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCL 611

  Fly   275 VKEPDDRATATELLEHEFIRNAKHRSILKPMLEETCAIREQ 315
            |.:||.||..||||.|.|::.||..|.|.|.:.   |:||:
 Worm   612 VVDPDQRADTTELLAHPFLKKAKPLSSLIPYIR---AVREK 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 101/266 (38%)
S_TKc 42..293 CDD:214567 101/253 (40%)
Mst1_SARAH 608..655 CDD:288481
max-2NP_001300485.1 STKc_PAK 378..631 CDD:270789 102/255 (40%)
S_TKc 379..630 CDD:214567 101/253 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.