DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and Stlk

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster


Alignment Length:303 Identity:75/303 - (24%)
Similarity:135/303 - (44%) Gaps:51/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YKLGE----GSYGSVYKAVHKESSSIVAIKLVPVESDLHEI------IKEISIMQQCDSPYVVRY 100
            |||.|    |..|:|||| ...::..:|:|.|.::..:.::      :..:..:|..:...:|..
  Fly    10 YKLLEILKNGMIGTVYKA-EDINNKCLAVKKVSMDQPMEKLTLLFNEVLTVRRLQHRNINTIVSC 73

  Fly   101 YGSYFKQYDLWICMEYCGAGSVSDIMR-LRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKA 164
            :  .:||| :::..::...|:...::: :......|..||.||.|.|..|.|:|....:|..::|
  Fly    74 F--LYKQY-VYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSEHYVHGSVRA 135

  Fly   165 ANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTP-------FWMAPEVIEE--IGYDCVADIW 220
            .:|||:.. .|.|::|...........|:..:.|:.       :|.||||:.:  .||....||:
  Fly   136 KHILLSPR-KAVLSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSGYTEKIDIY 199

  Fly   221 SLGITALEMAEGKPPYGE-------IHPMRAIF--------MIPQKPPPSFREPDR--------- 261
            |:|||..|||.|..|:.:       |..:|...        ::..:...|....::         
  Fly   200 SIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEHTNKRIARDVIVN 264

  Fly   262 --WSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSIL 302
              :|..|..||..||.|.|..|..|::|:.|.|::..::.|:|
  Fly   265 KSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRNTSLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 72/292 (25%)
S_TKc 42..293 CDD:214567 72/292 (25%)
Mst1_SARAH 608..655 CDD:288481
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 75/303 (25%)
S_TKc 10..298 CDD:214567 72/292 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.