DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and Pak6

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001099968.1 Gene:Pak6 / 296078 RGDID:1306213 Length:681 Species:Rattus norvegicus


Alignment Length:281 Identity:108/281 - (38%)
Similarity:158/281 - (56%) Gaps:10/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHE--IIKEISIMQQCDSPYVVRY 100
            |..:.|...|:||||.|.|..|..|.|...||:|::.:......  :..|:.||:......||..
  Rat   403 PRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEM 467

  Fly   101 YGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAA 165
            |.||....:||:.||:...|:::||  :.:..|.|::|||:....||.|.|||.:..||||||:.
  Rat   468 YKSYLVGEELWVLMEFLQGGALTDI--ISQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSD 530

  Fly   166 NILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMA 230
            :|||..:|..||:|||...|::..:.||.:::|||:|||||||....|....|||||||..:||.
  Rat   531 SILLTLDGRVKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMV 595

  Fly   231 EGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRN 295
            :|:|||....|::|:..:...|||..:...:.|....||:.:.||:||.:||||.|||:|.|:..
  Rat   596 DGEPPYFSDSPVQAMKRLRDSPPPKLKNSYKVSPVLRDFLERMLVREPQERATAQELLDHPFLLQ 660

  Fly   296 AKHRSILKPMLE------ETC 310
            ......|.|:::      .||
  Rat   661 TGLPECLVPLIQLYRKQTSTC 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 103/256 (40%)
S_TKc 42..293 CDD:214567 102/252 (40%)
Mst1_SARAH 608..655 CDD:288481
Pak6NP_001099968.1 PBD 11..67 CDD:395634
STKc_PAK6 385..681 CDD:270821 106/279 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.