DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and ppk11

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_594517.1 Gene:ppk11 / 2541473 PomBaseID:SPAC2C4.14c Length:312 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:124/272 - (45%)
Similarity:179/272 - (65%) Gaps:5/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGEGSYGSVYKAVHKESSSIVAIKLVPVES---DLHEIIKEISIMQQCDSPYVVRYYGSYFKQYD 109
            :|:||:|||::|...|||.|||:|:|.:::   .:..:.:||:.:...:|.::.:||.|:...:.
pombe    12 IGQGSFGSVFRAQDVESSKIVALKVVDLDATKDQIETLTQEINFLIDLNSVHITKYYASFVDGFR 76

  Fly   110 LWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGY 174
            |||.||||..||..|:::| ..|.:|..||.::...|:.|||||.:.|:||||||||||...:|.
pombe    77 LWITMEYCDGGSCLDLLKL-SGTFSERVIAEVMRQVLEALVYLHGQGKMHRDIKAANILTMKDGL 140

  Fly   175 AKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEI 239
            .|||||||:|||.....|.:..:||||||||||:::.||:..||||||||||.|:|.|:|||..|
pombe   141 VKLADFGVSGQLESLRDKNDDFVGTPFWMAPEVVKQTGYNYKADIWSLGITAYELATGEPPYSGI 205

  Fly   240 HPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKP 304
            |||:.:.:||:..|||. |..::|..|.||||.||.|.|.|||||..|.:|:||:.....:.:|.
pombe   206 HPMKVLLLIPKHSPPSL-ERSKFSRAFCDFVSNCLKKNPKDRATAEYLSKHKFIKKYCPNTSVKE 269

  Fly   305 MLEETCAIREQQ 316
            ::......:|.:
pombe   270 VVASYAKWKESE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 120/247 (49%)
S_TKc 42..293 CDD:214567 120/247 (49%)
Mst1_SARAH 608..655 CDD:288481
ppk11NP_594517.1 STKc_MST3_like 4..278 CDD:270786 123/267 (46%)
S_TKc 6..258 CDD:214567 120/247 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.