DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and byr2

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_595714.2 Gene:byr2 / 2540612 PomBaseID:SPBC1D7.05 Length:659 Species:Schizosaccharomyces pombe


Alignment Length:302 Identity:101/302 - (33%)
Similarity:160/302 - (52%) Gaps:21/302 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SVVDMKSPNISSSCSFFKLKKLSEESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKL 72
            |.::..||...:|.:......|.|::..|..:.:...:  :|.||:|.||..::..|..::|:|.
pombe   362 SFIEQPSPISPTSTTSEDTNTLEEDTDDQSIKWIRGAL--IGSGSFGQVYLGMNASSGELMAVKQ 424

  Fly    73 VPVES-----DLH-----EIIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMR 127
            |.::|     |.|     .:..||:::|:....::|:|.||......|.|.:||...|||:.::.
pombe   425 VILDSVSESKDRHAKLLDALAGEIALLQELSHEHIVQYLGSNLNSDHLNIFLEYVPGGSVAGLLT 489

  Fly   128 LRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQL------ 186
            : ..:..|..:...:..||:||.|||.|..:|||||.||||::.:|..|::|||::.:|      
pombe   490 M-YGSFEETLVKNFIKQTLKGLEYLHSRGIVHRDIKGANILVDNKGKIKISDFGISKKLELNSTS 553

  Fly   187 TDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQK 251
            |.|...|.:..|:.|||||||:::..:....||||||...:||...|.||.....|:|||.|.:.
pombe   554 TKTGGARPSFQGSSFWMAPEVVKQTMHTEKTDIWSLGCLVIEMLTSKHPYPNCDQMQAIFRIGEN 618

  Fly   252 PPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFI 293
            ..|.|  |...|:..|||:.|....:.:.|.||:|||.|.|:
pombe   619 ILPEF--PSNISSSAIDFLEKTFAIDCNLRPTASELLSHPFV 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 93/270 (34%)
S_TKc 42..293 CDD:214567 93/266 (35%)
Mst1_SARAH 608..655 CDD:288481
byr2NP_595714.2 PKc_like 393..658 CDD:304357 93/269 (35%)
Pkinase 394..658 CDD:278497 93/268 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.