DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and MYO3B

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_011508956.1 Gene:MYO3B / 140469 HGNCID:15576 Length:1386 Species:Homo sapiens


Alignment Length:306 Identity:128/306 - (41%)
Similarity:191/306 - (62%) Gaps:17/306 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LSEESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIK-EISIMQQC 92
            |..|||..|.: .::|:..:|:|:||.|||..:|...|:.|:|::...||:.|.|: |.:|:|..
Human    24 LGLESLPDPTD-TWEIIETIGKGTYGKVYKVTNKRDGSLAAVKILDPVSDMDEEIEAEYNILQFL 87

  Fly    93 -DSPYVVRYYGSYFKQ-----YDLWICMEYCGAGSVSDIMR--LR-KKTLTEDEIATILSDTLQG 148
             :.|.||::||.::|.     ..||:.:|.|..|||:::::  || .:.|.|..|:.||...|.|
Human    88 PNHPNVVKFYGMFYKADHCVGGQLWLVLELCNGGSVTELVKGLLRCGQRLDEAMISYILYGALLG 152

  Fly   149 LVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIE---- 209
            |.:||..|.||||:|..||||.|||..||.||||:.|||.|..:|||.:|||||||||||.    
Human   153 LQHLHNNRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQ 217

  Fly   210 -EIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKC 273
             :..||...|:|||||||:|:.:|.||..::||::.:|.||:.|||:...|::|..||..|:|:|
Human   218 YDSSYDARCDVWSLGITAIELGDGDPPLFDMHPVKTLFKIPRNPPPTLLHPEKWCEEFNHFISQC 282

  Fly   274 LVKEPDDRATATELLEHEFIRNAKHRSILKPMLEETCAIREQQRAN 319
            |:|:.:.|.:.|.||:|.||:.. |..:|....:....:::|:..|
Human   283 LIKDFERRPSVTHLLDHPFIKGV-HGKVLFLQKQLAKVLQDQKHQN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 117/269 (43%)
S_TKc 42..293 CDD:214567 117/265 (44%)
Mst1_SARAH 608..655 CDD:288481
MYO3BXP_011508956.1 STKc_myosinIIIB_N 13..303 CDD:270808 123/279 (44%)
S_TKc 36..302 CDD:214567 117/265 (44%)
MYSc 355..1062 CDD:214580
MYSc_Myo3 366..1055 CDD:276830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.