DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and STK25

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001258906.1 Gene:STK25 / 10494 HGNCID:11404 Length:426 Species:Homo sapiens


Alignment Length:427 Identity:172/427 - (40%)
Similarity:236/427 - (55%) Gaps:73/427 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPV---ESDLHEIIKEISIMQQCDSPYVVR 99
            ||::|..:.::|:||:|.|||.:...:..:||||::.:   |.::.:|.:||:::.||||||:.|
Human    16 PEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITR 80

  Fly   100 YYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKA 164
            |:|||.|...|||.|||.|.||..|:  |:...|.|..|||||.:.|:||.|||..|||||||||
Human    81 YFGSYLKSTKLWIIMEYLGGGSALDL--LKPGPLEETYIATILREILKGLDYLHSERKIHRDIKA 143

  Fly   165 ANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEM 229
            ||:||:.:|..||||||||||||||..||||.:|||||||||||::..||..||||||||||:|:
Human   144 ANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIEL 208

  Fly   230 AEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFI- 293
            |:|:||..::||||.:|:||:..||:..  .:.|..|.:||..||.|:|..|.||.|||:|:|| 
Human   209 AKGEPPNSDLHPMRVLFLIPKNSPPTLE--GQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFIT 271

  Fly   294 RNAKHRSILKPML------------EETCA-----------------------IREQQRANRSFG 323
            |..|..|.|..::            ||:.:                       ||....:....|
Human   272 RYTKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKG 336

  Fly   324 GVLAASQAKSLATQENGMQQHITDNAFMEDPGTLVPEKFGEYQQSSASDATMIAHAEQGVDEGTL 388
            ..|.:||..:...:.....|.::         |||...|||.::.         |.:.|   |::
Human   337 TALHSSQKPAEPVKRQPRSQCLS---------TLVRPVFGELKEK---------HKQSG---GSV 380

  Fly   389 GPGGLRNLSKAAAPAAASSAASPLDMPAVDSGTMVEL 425
              |.|..|..|.:.|..|       .|.:....||.|
Human   381 --GALEELENAFSLAEES-------CPGISDKLMVHL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 138/257 (54%)
S_TKc 42..293 CDD:214567 136/253 (54%)
Mst1_SARAH 608..655 CDD:288481
STK25NP_001258906.1 STKc_STK25 15..291 CDD:270810 144/278 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..355 8/63 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D967913at2759
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.