DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rep and GDI2

DIOPT Version :9

Sequence 1:NP_477420.1 Gene:Rep / 37246 FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001485.2 Gene:GDI2 / 2665 HGNCID:4227 Length:445 Species:Homo sapiens


Alignment Length:497 Identity:122/497 - (24%)
Similarity:211/497 - (42%) Gaps:101/497 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFS-MDALCARLDQEVEPHSALR 70
            |::|::|:|||.||..::...|..||.|||:|.|.|||...:|.: ::.|..|......|..::.
Human     3 EEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMG 67

  Fly    71 NARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAV 135
            ..|               .||            :||.|:.|.|.|:||::|:.:.:.||.:|:..
Human    68 RGR---------------DWN------------VDLIPKFLMANGQLVKMLLYTEVTRYLDFKVT 105

  Fly   136 DHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSLEFRG-----R 195
            :...:...|:|..||.:.::...:..:.:.|||...|||....::.|    :|...|.|     .
Human   106 EGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDE----KDPRTFEGIDPKKT 166

  Fly   196 TFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFE----EGMQRTQRFLGSLGRYGNTPFLFPMYGC 256
            |..:..:...:.:.:......|:|:.......:    |.:.|.:.:..||.|||.:|:|:|:||.
Human   167 TMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGL 231

  Fly   257 GELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRAKNVVSAPGYTPVSKGIEL 321
            |||||.|.||.|:|||.|.|.:.:::|.: .|.....:.|.|:..|.|.::..|.|  |...:|.
Human   232 GELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGEIARCKQLICDPSY--VKDRVEK 293

  Fly   322 KPHISRGLFISSSPLGNEELNKGGGGVNLLRLL--DNEGGREA----FLIQLSHYTGACPEGLYI 380
            ...:.|.:.|.|.|:      |.....|..:::  .|:..|::    .:|..:|...|  :|.||
Human   294 VGQVIRVICILSHPI------KNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAA--QGKYI 350

  Fly   381 FHLTT------------PALS------------------EDPASDLAIFTSQLFDQSDAQIIFSS 415
            ..::|            |||.                  :|..::..||.|:.:|.       ::
Human   351 AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDA-------TT 408

  Fly   416 YFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIANARDIFGK 457
            :|.......|:      .|......|.|::.......||:|:
Human   409 HFETTCDDIKN------IYKRMTGSEFDFEEMKRKKNDIYGE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 110/435 (25%)
GDI2NP_001485.2 GDI 1..436 CDD:366408 119/487 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.