DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rep and GDI1

DIOPT Version :9

Sequence 1:NP_477420.1 Gene:Rep / 37246 FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001484.1 Gene:GDI1 / 2664 HGNCID:4226 Length:447 Species:Homo sapiens


Alignment Length:499 Identity:128/499 - (25%)
Similarity:212/499 - (42%) Gaps:101/499 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFS-MDALCARLDQEVEPHSA 68
            :.|::|::|:|||.||..::...|..||.|||:|.|.|||...||.: ::.|..|......|..:
Human     1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPES 65

  Fly    69 LRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFR 133
            :...|               .||            :||.|:.|.|.|:||::|:.:.:.||.:|:
Human    66 MGRGR---------------DWN------------VDLIPKFLMANGQLVKMLLYTEVTRYLDFK 103

  Fly   134 AVDHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFL---------------------TAC 177
            .|:...:...|:|..||.:.::...:..:.:.|||...|||                     |:.
Human   104 VVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSM 168

  Fly   178 ND-YGEDKCNEDSLEFRGRTFLEYLQAQRVTEKISS-CVMQAIAMCGPSTSFEEGMQRTQRFLGS 240
            .| |.:....:|.::|.|.....|    |..:.:.. |:              |.:.|.:.:..|
Human   169 RDVYRKFDLGQDVIDFTGHALALY----RTDDYLDQPCL--------------ETVNRIKLYSES 215

  Fly   241 LGRYGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRAKN 305
            |.|||.:|:|:|:||.|||||.|.||.|:|||.|.|.:.||||.:: |.....:.|.|:..|.|.
Human   216 LARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIME-NGKVVGVKSEGEVARCKQ 279

  Fly   306 VVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLL--DNEGGREA--FLIQ 366
            ::..|.|.|  ..:.....:.|.:.|.|.|:      |.....|..:::  .|:..|::  ::..
Human   280 LICDPSYIP--DRVRKAGQVIRIICILSHPI------KNTNDANSCQIIIPQNQVNRKSDIYVCM 336

  Fly   367 LSHYTGACPEGLYI------FHLTTPALSEDPASDLA-------IFTSQLF----DQSDAQIIFS 414
            :|:......:|.||      ...|.|....:||.:|.       :..|.|:    |..::|:..|
Human   337 ISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCS 401

  Fly   415 -SYFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIANARDIFGK 457
             ||.......:.....:.||.....| ..|::.......|:||:
Human   402 CSYDATTHFETTCNDIKDIYKRMAGT-AFDFENMKRKQNDVFGE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 113/425 (27%)
GDI1NP_001484.1 GDI 1..436 CDD:366408 125/489 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.