DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and NIP100

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_015151.1 Gene:NIP100 / 855929 SGDID:S000006095 Length:868 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:22/69 - (31%)
Similarity:36/69 - (52%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTC----APNYGGFVSPL--SVTVGDF 233
            :|.:::.|..:...|.:.|:|.|:|||||:||..|..||..    |.:.||:....  ..|:..:
Yeast    27 KGRVKFIGETQFAKGIWYGIELDKPLGKNDGSANGIRYFDIDLKKANSNGGYYGLFCKKDTLQFY 91

  Fly   234 PPED 237
            .|:|
Yeast    92 KPDD 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 19/53 (36%)
NIP100NP_015151.1 NIP100 12..828 CDD:227569 22/69 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.