DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TBCB and clip1a

DIOPT Version :9

Sequence 1:	NP_611425.1	Gene:	TBCB / 37244	FlyBaseID:	FBgn0034451	Length:	244	Species:	Drosophila melanogaster
Sequence 2:	XP_009300267.1	Gene:	clip1a / 797680	ZFINID:	ZDB-GENE-060526-282	Length:	1569	Species:	Danio rerio

Alignment Length:	135	Identity:	39/135 - (28%)
Similarity:	57/135 - (42%)	Gaps:	26/135 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   100 SAPVEKFELSKDQYEQRTDSVRNYLKINRMGKYNDEEMQQAEEKKRLQAEEIQKRAELCVLGGRC 164
            ::|.:....:.|....:::||.|.             .:....||..:..:|..|
Zfish   154 ASPTKAAAPTSDLVRSKSESVSNL-------------SESGSVKKGERELKINDR---------- 195

  Fly   165 EVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLSVT 229
             |.|.|  ::.|.:|:.|..:...|.:.|||.|||||||:|:..|..||.|.|.||.|.....||
Zfish   196 -VLVAG--SKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVT 257

  Fly   230 VGDFP 234
            ...||
Zfish   258 RIGFP 262

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TBCB	NP_611425.1	Alp11_N	12..95	CDD:176384
TBCB	NP_611425.1	CAP_GLY	161..225	CDD:279625	26/63 (41%)
clip1a	XP_009300267.1	CAP_GLY	55..118	CDD:279625
		CAP_GLY	193..256	CDD:279625	27/75 (36%)
		Smc	<333..1004	CDD:224117
		SCP-1	709..1402	CDD:114219
		COG7	720..>871	CDD:287200
		SPEC	940..1119	CDD:295325
		GluZincin	1227..>1365	CDD:301352
		CLIP1_ZNF	1507..1524	CDD:293247
		CLIP1_ZNF	1547..1563	CDD:293247
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910