DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and Clip4

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_084455.2 Gene:Clip4 / 78785 MGIID:1919100 Length:704 Species:Mus musculus


Alignment Length:82 Identity:37/82 - (45%)
Similarity:47/82 - (57%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AEEIQKRAELCVLGGRC--EVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGK 210
            ::....||.|..||.:.  .|.:.|.  :.||:|:.|..|..||.:.|:|.|||.||||||.|..
Mouse   269 SDHTTSRAMLTSLGLKLGDRVVIAGQ--KVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRV 331

  Fly   211 AYFTCAPNYGGFVSPLS 227
            .||.|||.||.| :|||
Mouse   332 QYFKCAPKYGIF-APLS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 31/66 (47%)
Clip4NP_084455.2 ANK 1 65..101
ANKYR <84..254 CDD:440430
ANK repeat 109..144 CDD:293786
ANK 2 149..180
ANK repeat 153..184 CDD:293786
ANK repeat 186..217 CDD:293786
ANK 3 186..215
CAP_GLY 285..349 CDD:460154 32/66 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..479
CAP_GLY 486..550 CDD:460154
CAP_GLY 625..689 CDD:460154
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.