DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and Clip3

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001074583.1 Gene:Clip3 / 76686 MGIID:1923936 Length:547 Species:Mus musculus


Alignment Length:145 Identity:50/145 - (34%)
Similarity:65/145 - (44%) Gaps:40/145 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NRMGKYNDE------EMQQAEEKKRLQAEEIQKRAE-----LCVLGGRCEVT------VPGN--- 171
            ||.|:...|      :|...:.:..|.|:|::...|     .|.|.   :||      ||||   
Mouse   228 NRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCTLP---KVTLPNYDNVPGNLML 289

  Fly   172 --------------PTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGF 222
                          ..:.||:|:.|..|..||.::|||.|||.|||:||.||..||.|.|..|.|
Mouse   290 SALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLF 354

  Fly   223 --VSPLSVTVGDFPP 235
              ||.:|..| |.||
Mouse   355 ASVSKVSKAV-DAPP 368

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 34/89 (38%)
Clip3NP_001074583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
ANKYR <101..>235 CDD:440430 3/6 (50%)
ANK 1 117..158
ANK repeat 120..157 CDD:293786
ANK repeat 159..190 CDD:293786
ANK 2 160..191