DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and Clip1

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_038945655.1 Gene:Clip1 / 65201 RGDID:67404 Length:2202 Species:Rattus norvegicus


Alignment Length:110 Identity:39/110 - (35%)
Similarity:53/110 - (48%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KINRMGKYNDEEMQQAEEKKRLQAEEIQKRAELCVLGGRCEVTVPGNPTRRGTIRYNGPLEGKSG 189
            :|:.:.|...|.:....|     |..::|......:|.|  |.|.|  |:.|.:|:.|..:...|
  Rat   183 QISNLTKTASESISNLSE-----AGSVKKGERELKIGDR--VLVGG--TKAGVVRFLGETDFAKG 238

  Fly   190 HFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLSVTVGDFP 234
            .:.|||.|||||||:|:..|..||.|.|.||.|.....||...||
  Rat   239 EWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 29/63 (46%)
Clip1XP_038945655.1 CAP_GLY 60..124 CDD:396049
CAP_GLY 213..277 CDD:396049 29/67 (43%)
SbcC <344..802 CDD:223496
Smc 594..1345 CDD:224117
SMC_prok_B 1047..1919 CDD:274008
pneumo_PspA 1838..>2141 CDD:411490
CLIP1_ZNF 2180..2196 CDD:406934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.