DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and clip2

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_021332329.2 Gene:clip2 / 556406 ZFINID:ZDB-GENE-100727-3 Length:1041 Species:Danio rerio


Alignment Length:109 Identity:35/109 - (32%)
Similarity:54/109 - (49%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 RMGKYNDEEMQQAEEKKRLQAEEIQKRAELCVLGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFI 192
            :.|..:...|..:...|: ..|:..|..:..::||          |:.|.:||.|..:...|.:.
Zfish   180 KTGNESGSNMSDSGSVKK-GGEKDLKVGDRVLVGG----------TKTGVVRYVGETDFAKGEWC 233

  Fly   193 GVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLS--VTVGDFP 234
            |||.|||||||:|:..|..||.|.|.:|.| :|:.  :.:| ||
Zfish   234 GVELDEPLGKNDGAVAGTRYFQCPPKFGLF-APIHKVIRIG-FP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 26/64 (41%)
clip2XP_021332329.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.