DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and dctn1a

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_021333133.1 Gene:dctn1a / 407638 ZFINID:ZDB-GENE-070117-2205 Length:1232 Species:Danio rerio


Alignment Length:73 Identity:30/73 - (41%)
Similarity:40/73 - (54%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224
            :|...||...|   :|||:.|.|.....||.::||..||..|||:|:..||.||||..|:|.||.
Zfish    12 VGSVVEVIGKG---QRGTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVR 73

  Fly   225 PLSVTVGD 232
            ...:.:.|
Zfish    74 QSQIQLMD 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 29/63 (46%)
dctn1aXP_021333133.1 CAP_GLY 12..77 CDD:307465 29/67 (43%)
SMC_N <179..498 CDD:330553
Dynactin 490..768 CDD:315181
PhageMin_Tail 899..>1157 CDD:331379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1550378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.