DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and CG9279

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649124.1 Gene:CG9279 / 40124 FlyBaseID:FBgn0036882 Length:1339 Species:Drosophila melanogaster


Alignment Length:76 Identity:32/76 - (42%)
Similarity:39/76 - (51%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFV- 223
            ||.|.|||   ....:|.:.|.|.....:|.:.||..||||||||||..|..||.|..|.|.|| 
  Fly     9 LGQRVEVT---GKNLQGKVAYVGRTNFAAGLWYGVVLDEPLGKNNGSVHGSIYFKCPTNCGLFVR 70

  Fly   224 SPLSVTVGDFP 234
            :...|.:.:.|
  Fly    71 AQQLVRIAELP 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 29/64 (45%)
CG9279NP_649124.1 NIP100 7..642 CDD:227569 32/76 (42%)
CAP_GLY 10..74 CDD:279625 29/66 (44%)
Smc 422..>1276 CDD:224117
PCRF 422..>490 CDD:305100
Dynactin 702..965 CDD:289240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1550378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.