DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and CLIP-190

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster


Alignment Length:78 Identity:29/78 - (37%)
Similarity:41/78 - (52%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGGRCEVTV-------PGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAP 217
            :||:..:.|       .|..:|.|.:||.|..:...|::.|||.|||.|||:|:.....||.|.|
  Fly   231 IGGKNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKP 295

  Fly   218 NYGGFVSPLSVTV 230
            .||.||....|::
  Fly   296 KYGVFVPIAKVSL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 28/70 (40%)
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039
CAP_GLY 125..189 CDD:396049
CAP_GLY 239..306 CDD:396049 26/66 (39%)
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.