DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and Clip4

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001415539.1 Gene:Clip4 / 298801 RGDID:1311049 Length:717 Species:Rattus norvegicus


Alignment Length:76 Identity:36/76 - (47%)
Similarity:45/76 - (59%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RAELCVLGGRC--EVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCA 216
            :|.|..||.:.  .|.:.|.  :.||:|:.|..|..||.:.|:|.|||.||||||.|...||.||
  Rat   275 KAMLTTLGLKLGDRVVIAGQ--KVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCA 337

  Fly   217 PNYGGFVSPLS 227
            |.||.| :|||
  Rat   338 PKYGIF-APLS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 31/66 (47%)
Clip4NP_001415539.1 ANK 1 65..101
ANK 2 149..180
ANK 3 186..215
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.