DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and Clip2

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_034120.2 Gene:Clip2 / 269713 MGIID:1313136 Length:1047 Species:Mus musculus


Alignment Length:77 Identity:34/77 - (44%)
Similarity:45/77 - (58%) Gaps:8/77 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224
            ||.|  |.|.|  |:.|.:||.|..:...|.:.|||.|||||||:|:..|..||.|.|.:|.| :
Mouse   222 LGDR--VLVGG--TKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLF-A 281

  Fly   225 PLS--VTVGDFP 234
            |:.  :.:| ||
Mouse   282 PIHKVIRIG-FP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 29/63 (46%)
Clip2NP_034120.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
CAP_GLY 83..146 CDD:279625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..164
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..216
CAP_GLY 223..286 CDD:279625 30/67 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..340
DUF4349 <380..485 CDD:305044
mycoplas_twoTM 572..>658 CDD:275320
TTKRSYEDQ <683..871 CDD:287216
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1022..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.