powered by:
Protein Alignment TBCB and Clip2
DIOPT Version :9
Sequence 1: | NP_611425.1 |
Gene: | TBCB / 37244 |
FlyBaseID: | FBgn0034451 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034120.2 |
Gene: | Clip2 / 269713 |
MGIID: | 1313136 |
Length: | 1047 |
Species: | Mus musculus |
Alignment Length: | 77 |
Identity: | 34/77 - (44%) |
Similarity: | 45/77 - (58%) |
Gaps: | 8/77 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224
||.| |.|.| |:.|.:||.|..:...|.:.|||.|||||||:|:..|..||.|.|.:|.| :
Mouse 222 LGDR--VLVGG--TKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLF-A 281
Fly 225 PLS--VTVGDFP 234
|:. :.:| ||
Mouse 282 PIHKVIRIG-FP 292
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.