DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and tbcb-1

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_506367.1 Gene:tbcb-1 / 186176 WormBaseID:WBGene00009987 Length:229 Species:Caenorhabditis elegans


Alignment Length:250 Identity:93/250 - (37%)
Similarity:129/250 - (51%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IETGKSDFIKVNVSNSHNDAVAFEVKLAKDLTVAQLKTKLEILTGGCAGTMKVQVFKGDTCVSTM 69
            |.|..:||             ..|.|....:::..||.|||::.|....:|::|:|.||      
 Worm     9 ITTNATDF-------------PMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGD------ 54

  Fly    70 DNNDAQLGYYANS-------DGLRLHVVD-SFATFSF-DSAPVEKFELSKDQYEQRTDSVRNYLK 125
            |....:|...|.|       ||.|:|.|| :.....| |.:.|||:|:|.|.|.:||||||.:.|
 Worm    55 DQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNEDFKDESMVEKYEMSDDTYGKRTDSVRAWKK 119

  Fly   126 INRMGKYNDEEMQQA---EEKKRLQAEEIQKRAELCVLGGRCEVTVPGNPTRRGTIRYNGPLEGK 187
                 |..:|:...|   .|..:|..|    .|:..::|.||||||.....|||.:.|.|..:.|
 Worm   120 -----KMQEEQGSAAPMENESDKLNEE----AAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFK 175

  Fly   188 SGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLSVTVGDFPPEDFNMDD 242
            .|.::||:||||:|||:||..|..||.|.|.|||||.|:.|.|||||  :.::|:
 Worm   176 EGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFP--ELSIDE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384 24/90 (27%)
CAP_GLY 161..225 CDD:279625 35/63 (56%)
tbcb-1NP_506367.1 Alp11_N 4..87 CDD:176384 27/96 (28%)
CAP_GLY 149..216 CDD:279625 36/66 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3206
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H981
Inparanoid 1 1.050 139 1.000 Inparanoid score I3085
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54068
OrthoDB 1 1.010 - - D1550378at2759
OrthoFinder 1 1.000 - - FOG0003696
OrthoInspector 1 1.000 - - oto18150
orthoMCL 1 0.900 - - OOG6_102852
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R50
SonicParanoid 1 1.000 - - X4116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.