DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and dnc-1

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001255521.1 Gene:dnc-1 / 177987 WormBaseID:WBGene00001017 Length:1351 Species:Caenorhabditis elegans


Alignment Length:73 Identity:26/73 - (35%)
Similarity:37/73 - (50%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224
            :|.|.: |..||    |.:.:.|..:...|.::||..|...|||||:.....||.|.||:|.||.
 Worm     5 IGTRVK-TSSGN----GRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVK 64

  Fly   225 PLSVTVGD 232
            ..:|.:.|
 Worm    65 SSAVELED 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 24/63 (38%)
dnc-1NP_001255521.1 CAP_GLY 5..68 CDD:366568 24/67 (36%)
PHA03247 <71..306 CDD:223021 1/2 (50%)
Smc <366..648 CDD:224117
Dynactin 630..914 CDD:372121
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1550378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.