powered by:
Protein Alignment TBCB and dnc-1
DIOPT Version :9
Sequence 1: | NP_611425.1 |
Gene: | TBCB / 37244 |
FlyBaseID: | FBgn0034451 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255521.1 |
Gene: | dnc-1 / 177987 |
WormBaseID: | WBGene00001017 |
Length: | 1351 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 37/73 - (50%) |
Gaps: | 5/73 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224
:|.|.: |..|| |.:.:.|..:...|.::||..|...|||||:.....||.|.||:|.||.
Worm 5 IGTRVK-TSSGN----GRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVK 64
Fly 225 PLSVTVGD 232
..:|.:.|
Worm 65 SSAVELED 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1550378at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.