DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and clip-1

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001022682.1 Gene:clip-1 / 176307 WormBaseID:WBGene00010796 Length:937 Species:Caenorhabditis elegans


Alignment Length:56 Identity:25/56 - (44%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLSVTV 230
            :|.:||.||:.||.|.|.|:|..||.||::|:|.|.:||...|.:|.|.....||:
 Worm    32 KGFLRYVGPIHGKDGMFCGIELLEPNGKHDGTFQGVSYFIATPYHGIFAPIFRVTL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 23/49 (47%)
clip-1NP_001022682.1 CAP_GLY 21..85 CDD:460154 23/52 (44%)
PTZ00121 <364..793 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.