DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbcb and CLIP-190

DIOPT Version :10

Sequence 1:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_061513552.1 Gene:CLIP-190 / 1280169 VectorBaseID:AGAMI1_003611 Length:1967 Species:Anopheles gambiae


Alignment Length:78 Identity:31/78 - (39%)
Similarity:42/78 - (53%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 KRAELCVLGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAP 217
            |.|.|.| |.|..|: .|..:|.|.:::.|..:..||.:.||:.||..|||:|:..|..||.|..
Mosquito   334 KAASLNV-GDRVIVS-SGFGSRPGMLKFIGETQFASGTWCGVQLDEASGKNDGTVDGVRYFECPA 396

  Fly   218 NYGGFVSPLSVTV 230
            .||.||....||:
Mosquito   397 KYGIFVPIAKVTL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 25/64 (39%)
CLIP-190XP_061513552.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.