DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and TBCB

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001272.2 Gene:TBCB / 1155 HGNCID:1989 Length:244 Species:Homo sapiens


Alignment Length:236 Identity:105/236 - (44%)
Similarity:148/236 - (62%) Gaps:9/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IKVNVSNSHNDAVAFEVKLAKDLTVAQLKTKLEILTGGCAGTMKVQVF-KGDTCVSTMDNNDAQL 76
            :.|.:|:|.| ....|.:.::.||:|:.|.|||:|.|..|..|::::: ..|...|.:|..||.|
Human    11 VTVFISSSLN-TFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALL 74

  Fly    77 GYYANSDGLRLHVVD-SFATFS--FDSAPVEKFELSKDQYEQRTDSVRNYLKINRMGKYNDEE-- 136
            |.|...||.|:||:| |.|...  .|.:.|||:.:|::.|:||.|:||::||.:::|:||:||  
Human    75 GSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERA 139

  Fly   137 MQQAEEKKRLQAEEIQKRAELCVLGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLG 201
            .|:||..:||..|:.|  |....:|.||||...|...||||:.|.|..:.|.|::|||.||||||
Human   140 QQEAEAAQRLAEEKAQ--ASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLG 202

  Fly   202 KNNGSFGGKAYFTCAPNYGGFVSPLSVTVGDFPPEDFNMDD 242
            ||:||..||.||.|...||.||.|..|||||||.||:.:|:
Human   203 KNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384 31/83 (37%)
CAP_GLY 161..225 CDD:279625 36/63 (57%)
TBCBNP_001272.2 Ubiquitin_2 11..93 CDD:373130 31/83 (37%)
CAP_GLY 161..226 CDD:366568 36/64 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152544
Domainoid 1 1.000 72 1.000 Domainoid score I9415
eggNOG 1 0.900 - - E1_KOG3206
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H981
Inparanoid 1 1.050 188 1.000 Inparanoid score I3933
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54068
OrthoDB 1 1.010 - - D1550378at2759
OrthoFinder 1 1.000 - - FOG0003696
OrthoInspector 1 1.000 - - oto89292
orthoMCL 1 0.900 - - OOG6_102852
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R50
SonicParanoid 1 1.000 - - X4116
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.