DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCB and clip1b

DIOPT Version :9

Sequence 1:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_021335153.1 Gene:clip1b / 100537790 ZFINID:ZDB-GENE-111111-7 Length:862 Species:Danio rerio


Alignment Length:118 Identity:37/118 - (31%)
Similarity:56/118 - (47%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TDSVRNYLKINRMGKYNDEEMQQAEEKKRLQAEEIQKRAELCVLGGRCEVTVPGNPTRRGTIRYN 181
            |.:.||...:.|....:...:.:.:..|::|.|  .|..:..::||          ::.|.:|:.
Zfish   149 TVNTRNSSNLTRTASESASNLSETDSAKKIQRE--LKLGDRVLVGG----------SKAGVVRFL 201

  Fly   182 GPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLSVTVGDFP 234
            |..:...|.:.|||.|||||||:|:..|..||.|.|.||.|.....||...||
Zfish   202 GETDFAKGEWCGVELDEPLGKNDGAVAGGRYFQCLPKYGLFAPTHKVTRIGFP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 25/63 (40%)
clip1bXP_021335153.1 CAP_GLY 50..114 CDD:307465
CAP_GLY 184..248 CDD:307465 25/73 (34%)
SH3_and_anchor <307..>410 CDD:275056
SMC_N <368..721 CDD:330553
CLIP1_ZNF 800..817 CDD:318782
CLIP1_ZNF 840..856 CDD:318782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.