powered by:
Protein Alignment TBCB and dctn1b
DIOPT Version :9
Sequence 1: | NP_611425.1 |
Gene: | TBCB / 37244 |
FlyBaseID: | FBgn0034451 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021336434.1 |
Gene: | dctn1b / 100003026 |
ZFINID: | ZDB-GENE-050419-28 |
Length: | 1264 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 29/64 - (45%) |
Similarity: | 37/64 - (57%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFV 223
:|...||...|: |||:.|.|.....||.::||..|||.|||:|:..||.||.|..|:|.||
Zfish 31 VGSLVEVIGKGH---RGTVAYIGNTLFASGKWVGVILDEPKGKNDGTVQGKRYFLCQENHGIFV 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1550378at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.