DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub56D and TUBG2

DIOPT Version :9

Sequence 1:NP_725896.1 Gene:betaTub56D / 37238 FlyBaseID:FBgn0284243 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens


Alignment Length:281 Identity:108/281 - (38%)
Similarity:170/281 - (60%) Gaps:16/281 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQI 93
            ||:.:..||||...|.....:....:|.:|::.:|....|:|||||:||||..:.|:.:.|:.::
Human    21 FWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKL 85

  Fly    94 FRPDNFVFGQ--SGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQ---------GFQLTHS 147
            :.|:|....:  .|||||||.| :::|.::.:.:.|::.:||:..|.|:         ||.|.||
Human    86 YNPENIYLSEHGGGAGNNWASG-FSQGEKIHEDIFDIIDREADGSDSLELQNSSRVIKGFVLCHS 149

  Fly   148 LGGGTGSGMGTLLISKIREEYPDRIMNTYSVVP-SPKVSDTVVEPYNATLSVHQLVENTDETYCI 211
            :.||||||:|:.|:.::.:.||.:::.||||.| ..::||.||:|||:.|::.:|.:|.|....:
Human   150 IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVL 214

  Fly   212 DNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFM 276
            ||.||..|....|.:..|::..:|.|||..||..||.||:||.:|.||..|..:::|.|||||.|
Human   215 DNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLM 279

  Fly   277 PGFAPLTSRGSQQYR-ALTVP 296
            .|:.|||:  .|..| |.:||
Human   280 TGYTPLTT--DQSVRAAFSVP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub56DNP_725896.1 beta_tubulin 26..435 CDD:276956 108/281 (38%)
PLN00220 29..438 CDD:215107 108/281 (38%)
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 104/274 (38%)
INTAP 306..>379 CDD:318758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.