DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub56D and Y19D2B.1

DIOPT Version :9

Sequence 1:NP_725896.1 Gene:betaTub56D / 37238 FlyBaseID:FBgn0284243 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_496352.1 Gene:Y19D2B.1 / 189479 WormBaseID:WBGene00012489 Length:85 Species:Caenorhabditis elegans


Alignment Length:74 Identity:31/74 - (41%)
Similarity:47/74 - (63%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 IGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADE 441
            :.::|||.|.:.|:..:|..|:.::||:|||.||||:|.|||||.   .||.:..:.|:|..||.
 Worm    13 LSDTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAR---EDLAALEKDYEEVGADS 74

  Fly   442 DAEFEEEQE 450
            :...||:.|
 Worm    75 NEGLEEDGE 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub56DNP_725896.1 beta_tubulin 26..435 CDD:276956 24/57 (42%)
PLN00220 29..438 CDD:215107 26/60 (43%)
Y19D2B.1NP_496352.1 Tubulin_FtsZ_Cetz-like <9..70 CDD:299146 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.