powered by:
Protein Alignment betaTub56D and Y19D2B.1
DIOPT Version :9
Sequence 1: | NP_725896.1 |
Gene: | betaTub56D / 37238 |
FlyBaseID: | FBgn0284243 |
Length: | 456 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496352.1 |
Gene: | Y19D2B.1 / 189479 |
WormBaseID: | WBGene00012489 |
Length: | 85 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 31/74 - (41%) |
Similarity: | 47/74 - (63%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 IGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADE 441
:.::|||.|.:.|:..:|..|:.::||:|||.||||:|.|||||. .||.:..:.|:|..||.
Worm 13 LSDTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAR---EDLAALEKDYEEVGADS 74
Fly 442 DAEFEEEQE 450
:...||:.|
Worm 75 NEGLEEDGE 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5023 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.