DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and ELC1

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_015279.1 Gene:ELC1 / 856061 SGDID:S000005967 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:96 Identity:37/96 - (38%)
Similarity:60/96 - (62%) Gaps:6/96 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVR 87
            :|.|:|.|..|:.:.|..|:.|.|::||:.||  |.|:: ..:..::..||:|:|...|..|.::
Yeast     5 FVTLVSKDDKEYEISRSAAMISPTLKAMIEGP--FRESK-GRIELKQFDSHILEKAVEYLNYNLK 66

  Fly    88 YTNSS---TEIPEFPIAPEIALELLMAANFL 115
            |:..|   .|||||.|..|::||||:||::|
Yeast    67 YSGVSEDDDEIPEFEIPTEMSLELLLAADYL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 37/96 (39%)
ELC1NP_015279.1 BTB_POZ_EloC 5..99 CDD:349630 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345493
Domainoid 1 1.000 44 1.000 Domainoid score I3152
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1691
Isobase 1 0.950 - 0 Normalized mean entropy S487
OMA 1 1.010 - - QHG54458
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 1 1.000 - - oto99462
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - LDO PTHR20648
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R387
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.