DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and AT5G59140

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_568900.1 Gene:AT5G59140 / 836032 AraportID:AT5G59140 Length:96 Species:Arabidopsis thaliana


Alignment Length:92 Identity:44/92 - (47%)
Similarity:64/92 - (69%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVRY 88
            |||||.:|.|||:.||.|:.|.|||:||:.||.|:|::...|.|.:|.:.:|:|:|.||.:.::|
plant     5 VKLISMEGFEFVIDREAAMVSQTIRSMLTSPGGFSESKDGVVTFPDISTTILEKICQYFYWSLQY 69

  Fly    89 TNSSTEIPEFPIAPEIALELLMAANFL 115
            :....  .||.|.||:.|||:||||:|
plant    70 SRGKE--TEFHIEPELTLELMMAANYL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 44/92 (48%)
AT5G59140NP_568900.1 BTB_POZ_EloC 4..96 CDD:349630 44/92 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3691
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38083
Inparanoid 1 1.050 88 1.000 Inparanoid score I2307
OMA 1 1.010 - - QHG54458
OrthoDB 1 1.010 - - D1538795at2759
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 1 1.000 - - oto3542
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - LDO PTHR20648
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.