DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and ELOC

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001191786.1 Gene:ELOC / 6921 HGNCID:11617 Length:112 Species:Homo sapiens


Alignment Length:114 Identity:103/114 - (90%)
Similarity:108/114 - (94%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MDEQRGDKIYGGCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFR 68
            ||.:  :|.||||||||||||||||||||||:||||||||||||:|||||||||||||.|||:||
Human     1 MDGE--EKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFR 63

  Fly    69 EIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 117
            |||||||.|||||||||||||||||||||||||||||||||||||||||
Human    64 EIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 88/93 (95%)
ELOCNP_001191786.1 BTB_POZ_EloC 18..112 CDD:349630 88/93 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156670
Domainoid 1 1.000 124 1.000 Domainoid score I5568
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38083
Inparanoid 1 1.050 212 1.000 Inparanoid score I3649
Isobase 1 0.950 - 0 Normalized mean entropy S487
OMA 1 1.010 - - QHG54458
OrthoDB 1 1.010 - - D1538795at2759
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 1 1.000 - - oto89588
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - LDO PTHR20648
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R387
SonicParanoid 1 1.000 - - X2559
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.