DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and F54F7.10

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001123148.1 Gene:F54F7.10 / 6418855 WormBaseID:WBGene00077680 Length:138 Species:Caenorhabditis elegans


Alignment Length:94 Identity:40/94 - (42%)
Similarity:56/94 - (59%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVR 87
            ||||:|:|.||:.::|:.|.||..||.||..||:...|  ..|:...:.|..|||||.|..|:.:
 Worm    46 YVKLVSNDNHEYYIQRDLAETSRIIRDMLHCPGRSTSN--CTVYLHMVNSRTLQKVCHYLAYQKQ 108

  Fly    88 YTNSSTEIPEFPIAPEIALELLMAANFLD 116
            |...:.||..|.|.|..|::||:.|.||:
 Worm   109 YLRRNGEIESFNIEPAGAMDLLLVAGFLE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 40/94 (43%)
F54F7.10NP_001123148.1 BTB_POZ_EloC 46..138 CDD:349630 40/94 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54458
OrthoDB 1 1.010 - - D1538795at2759
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - O PTHR20648
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.