DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and eloca

DIOPT Version :10

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001004673.1 Gene:eloca / 447935 ZFINID:ZDB-GENE-040912-120 Length:113 Species:Danio rerio


Alignment Length:108 Identity:100/108 - (92%)
Similarity:105/108 - (97%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DKIYGGCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHV 74
            ::.||||||||||||||||||||||:||||||||||||:|||||||||||||.|||:||||||||
Zfish     6 ERNYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHV 70

  Fly    75 LQKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 117
            |.|||||||||||||||||||||||||||||||||||||||||
Zfish    71 LSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 88/93 (95%)
elocaNP_001004673.1 BTB_POZ_EloC 19..113 CDD:349630 88/93 (95%)

Return to query results.
Submit another query.