DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and eloca

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001004673.1 Gene:eloca / 447935 ZFINID:ZDB-GENE-040912-120 Length:113 Species:Danio rerio


Alignment Length:108 Identity:100/108 - (92%)
Similarity:105/108 - (97%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DKIYGGCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHV 74
            ::.||||||||||||||||||||||:||||||||||||:|||||||||||||.|||:||||||||
Zfish     6 ERNYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHV 70

  Fly    75 LQKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 117
            |.|||||||||||||||||||||||||||||||||||||||||
Zfish    71 LSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 88/93 (95%)
elocaNP_001004673.1 Skp1 17..113 CDD:214704 90/95 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592291
Domainoid 1 1.000 124 1.000 Domainoid score I5450
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3613
OMA 1 1.010 - - QHG54458
OrthoDB 1 1.010 - - D1538795at2759
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 1 1.000 - - otm26117
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - LDO PTHR20648
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R387
SonicParanoid 1 1.000 - - X2559
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.