DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and SPBC1861.07

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_596724.1 Gene:SPBC1861.07 / 2539714 PomBaseID:SPBC1861.07 Length:97 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:45/94 - (47%)
Similarity:64/94 - (68%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVR 87
            ||:|||.||..|::::|.|..||||||:|: .|.|:|.:.||..|.:|.:.:|:|||.|..|..|
pombe     5 YVRLISGDGFVFILEKEIACLSGTIRAILN-EGIFSEAQKNECTFPDIRATLLEKVCEYLHYNYR 68

  Fly    88 YTNSSTEIPEFPIAPEIALELLMAANFLD 116
            |.| ..:||:|.|.||:.||||:.|.:|:
pombe    69 YKN-QLDIPKFDIPPEMVLELLVTAEYLE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 45/94 (48%)
SPBC1861.07NP_596724.1 Skp1 3..96 CDD:214704 44/92 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3250
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1811
OMA 1 1.010 - - QHG54458
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 1 1.000 - - oto101068
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - LDO PTHR20648
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R387
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.