DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloC and elc-2

DIOPT Version :9

Sequence 1:NP_523794.1 Gene:EloC / 37237 FlyBaseID:FBgn0266711 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001362016.1 Gene:elc-2 / 24104987 WormBaseID:WBGene00001237 Length:141 Species:Caenorhabditis elegans


Alignment Length:103 Identity:49/103 - (47%)
Similarity:68/103 - (66%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAMLSGPGQFAENEANEVHFREIPSHVLQKVC 79
            |.|||.:.||||:|:|.|||::|||.|:||.::|.:.:.|........|.|:|.:..||:|||||
 Worm    40 GLEGPRSKYVKLVSNDDHEFIIKREVAMTSKSLRELFANPTVDLAAANNTVYFSDFQSHILQKVC 104

  Fly    80 MYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 117
            .|..||.:|.:|.. .|.|.|.|:||::||.|||.|:|
 Worm   105 HYLAYKTKYRHSRV-APPFDIPPDIAMDLLAAANELEC 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloCNP_523794.1 BTB_POZ_EloC 23..117 CDD:349630 44/93 (47%)
elc-2NP_001362016.1 BTB_POZ_EloC 48..141 CDD:349630 44/93 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164664
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S487
OMA 1 1.010 - - QHG54458
OrthoDB 1 1.010 - - D1538795at2759
OrthoFinder 1 1.000 - - FOG0001896
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102390
Panther 1 1.100 - - O PTHR20648
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.670

Return to query results.
Submit another query.