DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARF2

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_010144.1 Gene:ARF2 / 851418 SGDID:S000002296 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:60/168 - (35%)
Similarity:102/168 - (60%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNL 81
            :|.||::||:.:||::::...|.....|:|  ||:||.||.  :....:|....|:.|..|.|:|
Yeast    17 EMRILMVGLDGAGKTTVLYKLKLGEVITTI--PTIGFNVET--VQYKNISFTVWDVGGQDRIRSL 77

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |.|.::|..|:|:||||:||.|....::.:..:|...:|.|.:  .|.:.||.|:.:::|:.:|.
Yeast    78 WRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAV--WLVFANKQDLPEAMSAAEIT 140

  Fly   147 AALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            ..|.|.:|:::||.|.|:.|.|||||.||::||...::
Yeast   141 EKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 59/162 (36%)
ARF2NP_010144.1 ARF 5..179 CDD:128474 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.