DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and GB1

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_200034.1 Gene:GB1 / 835297 AraportID:AT5G52210 Length:205 Species:Arabidopsis thaliana


Alignment Length:174 Identity:50/174 - (28%)
Similarity:93/174 - (53%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDKMTILVLGLNNSGKSSIINHFK---KSSE--QTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSG 74
            |.:..:|:||::.:||::.:...|   ..||  ....:|||||..:.:  |.:|...|...|:.|
plant    15 KTEFNVLILGIDKAGKTTFLEKLKTIYSISEGLPHDRIVPTVGLNIGR--IEVSNAKIVFWDLGG 77

  Fly    75 ATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDS 139
            ....|::||..::..|.:||:||::...||...|..|:..|:|.||  :..|:|...||.|:.::
plant    78 QPGLRSIWEKYYEEAHALIYLIDAACPTRFEDSKSALEKALRHEDL--QGAPLLILANKQDLTNA 140

  Fly   140 LSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQM 183
            :|:.::...|.|:.:.::.:...:.|...|.|:.|.::||:..|
plant   141 VSAEELDRYLDLKKLDERVYMFEAVSGYDGRGIKESIEWLVGVM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 48/167 (29%)
GB1NP_200034.1 Arfrp1 19..183 CDD:206725 48/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.