DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARFB1B

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001331669.1 Gene:ARFB1B / 831569 AraportID:AT5G17060 Length:192 Species:Arabidopsis thaliana


Alignment Length:168 Identity:59/168 - (35%)
Similarity:96/168 - (57%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNL 81
            :|.:::|||:.:||::|:  :|....:....|||:||.||:  :....|.....|:.|..:.|.|
plant    17 EMRVVMLGLDAAGKTTIL--YKLHIGEVLSTVPTIGFNVEK--VQYKNVMFTVWDVGGQEKLRPL 77

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |.|.|.|..|:|||:||.||.|....|.|...:::.|.:.|.|  ||.:.||.||..::|..::.
plant    78 WRHYFNNTDGLIYVVDSLDRERIGKAKQEFQEIIKDPFMLNSI--ILVFANKQDMRGAMSPREVC 140

  Fly   147 AALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            ..|.|.::|::.|||..:.|:.|:||.||:.||...::
plant   141 EGLGLFDLKNRKWHIQGTCALRGDGLYEGLDWLSSTLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 58/162 (36%)
ARFB1BNP_001331669.1 Arf1_5_like 18..176 CDD:206717 59/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.