DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARFB1C

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_186962.1 Gene:ARFB1C / 821079 AraportID:AT3G03120 Length:192 Species:Arabidopsis thaliana


Alignment Length:163 Identity:58/163 - (35%)
Similarity:94/163 - (57%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNL 81
            :|.:::|||:.:||::|:  :|....:....|||:||.||:  :....|.....|:.|..:.|.|
plant    17 EMRVVMLGLDAAGKTTIL--YKLHIGEVLSTVPTIGFNVEK--VQYKNVIFTVWDVGGQEKLRPL 77

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |.|.|.|..|:|||:||.||.|....|.|...:::.|.:.|.:  ||.:.||.||..::|..::.
plant    78 WRHYFNNTDGLIYVVDSLDRERIGKAKQEFQDIIRDPFMLNSV--ILVFANKQDMRGAMSPREVC 140

  Fly   147 AALRLENIKDKPWHICSSSAISGEGLGEGVQWL 179
            ..|.|.::|::.|||..:.|:.|:||.||:.||
plant   141 EGLGLLDLKNRKWHIQGTCALQGDGLYEGLDWL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 57/161 (35%)
ARFB1CNP_186962.1 Arf1_5_like 18..176 CDD:206717 58/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.