DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARF3

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_850057.1 Gene:ARF3 / 817014 AraportID:AT2G24765 Length:182 Species:Arabidopsis thaliana


Alignment Length:165 Identity:58/165 - (35%)
Similarity:90/165 - (54%) Gaps:6/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNLWEH 84
            ||||||:|:||::|:  ::....:....:||:||.||.  :..:.:..:..|:.|.|..|..|..
plant    20 ILVLGLDNAGKTTIL--YRLQMGEVVSTIPTIGFNVET--VQYNNIKFQVWDLGGQTSIRPYWRC 80

  Fly    85 QFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIAAAL 149
            .|.|...:|||:||||..|..|.|:|...:|:..:|...:|  |.:.||.|:..:|....:..||
plant    81 YFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVV--LIFANKQDLPGALDDAAVTEAL 143

  Fly   150 RLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            .|..||.:.|.|..:.|:.||||.||:.||...::
plant   144 ELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 58/161 (36%)
ARF3NP_850057.1 Arl1 19..176 CDD:206718 58/161 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.