DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and TTN5

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_179430.1 Gene:TTN5 / 816354 AraportID:AT2G18390 Length:185 Species:Arabidopsis thaliana


Alignment Length:196 Identity:70/196 - (35%)
Similarity:112/196 - (57%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGF----MVEQFYIG 61
            ||:| ::...||.|:.:|.||::||:||||::|:  .|.:.|.||::.||:||    ::.|.|  
plant     1 MGLL-SIIRKIKKKEKEMRILMVGLDNSGKTTIV--LKINGEDTSVISPTLGFNIKTIIYQKY-- 60

  Fly    62 MSGVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVP 126
                ::...|:.|....|:.|.:.|:...|:::|:||||..|....|.|||.:|:...|...  .
plant    61 ----TLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLAGS--S 119

  Fly   127 ILFYGNKMDMEDSLSSVKIAAALRLENI-KDKPWHICSSSAISGEGLGEGVQWLIQQM--RFAML 188
            :|...||.|::.:|:..:|...|.||:: |.:.|.|...||.:||||.||..||:|.:  |..||
plant   120 LLILANKQDIQGALTPDEIGKVLNLESMDKSRHWKIVGCSAYTGEGLLEGFDWLVQDIASRIYML 184

  Fly   189 N 189
            :
plant   185 D 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 59/167 (35%)
TTN5NP_179430.1 Arl2 17..176 CDD:206720 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.